Human ACTL8 protein

Catalog Number: BYT-ORB605542
Article Name: Human ACTL8 protein
Biozol Catalog Number: BYT-ORB605542
Supplier Catalog Number: orb605542
Alternative Catalog Number: BYT-ORB605542-20,BYT-ORB605542-100,BYT-ORB605542-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cancer/testis antigen 57 (CT57)
This Human ACTL8 protein spans the amino acid sequence from region 1-366aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 43.9 kDa
UniProt: Q9H568
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVA
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ACTL8.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ACTL8.