Human ABCD1 protein

Product Overview

• Article Name: Human ABCD1 protein
• Biozol Catalog Number: BYT-ORB623974
• Supplier Catalog Number: orb623974
• Alternative Catalog Number: BYT-ORB623974-100,BYT-ORB623974-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Adrenoleukodystrophy protein

Product Description

This Human ABCD1 protein spans the amino acid sequence from region 1-745aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 84.9 kDa
• UniProt: P33897
• Buffer: Lyophilized from 20 mM Tris-HCl, 0.15 M NaCl, 0.05% FOS12, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: MPVLSRPRPWRGNTLKRTAVLLALAAYGAHKVYPLVRQCLAPARGLQAPAGEPTQEASGVAAAKAGMNRVFLQRLLWLLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLARCIVRKDPRAFGWQLLQWLLIALPATFVNSAIRYLEGQLALSFRSRLVAHAYRLYFSQQTYYRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGLVVFLTA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 µg/ml can bind human PEX19,the EC50 of human PEX19 protein is 22.96-33.00 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 µg/ml can bind human PEX19, the EC50 of human PEX19 is 22.96-33.00 µg/ml.