Human OMA1 protein

Catalog Number: BYT-ORB623989
Article Name: Human OMA1 protein
Biozol Catalog Number: BYT-ORB623989
Supplier Catalog Number: orb623989
Alternative Catalog Number: BYT-ORB623989-100,BYT-ORB623989-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Metalloprotease-related protein 1
This Human OMA1 protein spans the amino acid sequence from region 14-524aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 74.7 kDa
UniProt: Q96E52
Buffer: Lyophilized from 20 mM Tris-HCl, 0.15 M NaCl, 0.05% FOS12, 6% Trehalose, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: HVFFRFNSLSNWRKCNTLASTSRGCHQVQVNHIVNKYQGLGVNQCDRWSFLPGNFHFYSTFNNKRTGGLSSTKSKEIWRITSKCTVWNDAFSRQLLIKEVTAVPSLSVLHPLSPASIRAIRNFHTSPRFQAAPVPLLLMILKPVQKLFAIIVGRGIRKWWQALPPNKKEVVKENIRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRSKLLLLGKEQFRLLSELEYEAWMEEFKNDMLTEKDARYLAVKEVLC
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 µg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 µg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 µg/ml.