Human Desmoglein 2 protein

Catalog Number: BYT-ORB624074
Article Name: Human Desmoglein 2 protein
Biozol Catalog Number: BYT-ORB624074
Supplier Catalog Number: orb624074
Alternative Catalog Number: BYT-ORB624074-1,BYT-ORB624074-100,BYT-ORB624074-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ARVC 10, ARVC10, ARVD 10, ARVD10, Cadherin family member 5, CDHF 5, CDHF5, CMD1BB, Desmoglein 2, Desmoglein-2, Desmoglein2, DSG 2, DSG2, DSG2_HUMAN, HDGC, HDGC included, Human Desmoglein colon, MGC117034, MGC117036, MGC117037
This Human Desmoglein 2 protein spans the amino acid sequence from region 50-609aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 67.5 kDa
UniProt: Q14126
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid: Tris-based buffer, 50% glycerol
Sequence: AWITAPVALREGEDLSKKNPIAKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREETPFFLLTGYALDAR GNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTG EIYTTSVTLDREEHSSYTLTVEARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADE I
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.