Human CD48 protein

Product Overview

• Article Name: Human CD48 protein
• Biozol Catalog Number: BYT-ORB624104
• Supplier Catalog Number: orb624104
• Alternative Catalog Number: BYT-ORB624104-1,BYT-ORB624104-100,BYT-ORB624104-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: B-lymphocyte activation marker BLAST-1 (BCM1 surface antigen) (Leukocyte antigen MEM-102) (SLAM family member 2) (SLAMF2) (Signaling lymphocytic activation molecule 2) (TCT.1) (CD48) (BCM1) (BLAST1)

Product Description

This Human CD48 protein spans the amino acid sequence from region 27-220aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 51.3 kDa
• UniProt: P09326
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 µg/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 µg/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.

The purity of CD48 was greater than 95% as determined by SEC-HPLC