Human EPHA3 protein

Product Overview

• Article Name: Human EPHA3 protein
• Biozol Catalog Number: BYT-ORB624108
• Supplier Catalog Number: orb624108
• Alternative Catalog Number: BYT-ORB624108-1,BYT-ORB624108-100,BYT-ORB624108-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: EPH-like kinase 4 (EK4) (hEK4) (HEK) (Human embryo kinase) (Tyrosine-protein kinase TYRO4) (Tyrosine-protein kinase receptor ETK1) (Eph-like tyrosine kinase 1) (ETK) (ETK1) (TYRO4)

Product Description

This Human EPHA3 protein spans the amino acid sequence from region 21-541aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 61.0 kDa
• UniProt: P29320
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRP

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 µg/ml can bind human EFNA5, the EC50 of the protein is 0.9734-1.179 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 µg/ml can bind human EFNA5, the EC50 of the protein is 0.9734-1.179 ng/ml.

Human EPHA3 protein his tag captured on COOH chip can bind Human EFNA5 protein Fc tag with an affinity constant of 13.8 nM as detected by LSPR Assay.

The purity of Human EPHA3 was greater than 95% as determined by SEC-HPLC