Human 2019-nCOV-S protein

Product Overview

• Article Name: Human 2019-nCOV-S protein
• Biozol Catalog Number: BYT-ORB638762
• Supplier Catalog Number: orb638762
• Alternative Catalog Number: BYT-ORB638762-1,BYT-ORB638762-100,BYT-ORB638762-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: /

Product Description

This Human 2019-nCOV-S protein spans the amino acid sequence from region 16-685aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 79.6 kDa
• UniProt: P0DTC2
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYL

Application Notes

• Application Notes: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 µg/ml can bind human ACE2, the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 µg/ml can bind SARS-CoV-2-S Antibody, the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 µg/ml can bind human ACE2, the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 µg/ml can bind SARS-CoV-2-S Antibody, the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml