Human Angiotensin-converting enzyme 2 protein

Product Overview

• Article Name: Human Angiotensin-converting enzyme 2 protein
• Biozol Catalog Number: BYT-ORB640280
• Supplier Catalog Number: orb640280
• Alternative Catalog Number: BYT-ORB640280-1,BYT-ORB640280-100,BYT-ORB640280-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: /

Product Description

This Human Angiotensin-converting enzyme 2 protein spans the amino acid sequence from region 18-740aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 112.5 kDa
• UniProt: Q9BYF1
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 µg/ml can bind human ACE2, the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD at 5 µg/ml can bind human ACE2, the EC50 of human ACE2 protein is 31.80 - 44.69 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD at 5 µg/ml can bind human ACE2, the EC50 is 2.785-9.139 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized human ACE2 at 2 µg/ml can bind SARS-CoV-2-S1-RBD, the EC50 of human ACE2 protein is 8.363-12.82 ng/ml.

SARS-CoV-2 Spike protein RBD his/sumostar tag captured on COOH chip can bind Human ACE2 protein Fc tag with an affinity constant of 100 nM as detected by LSPR Assay.

SARS-CoV-2 Spike protein RBD his/myc tag captured on COOH chip can bind Human ACE2 protein Fc tag with an affinity constant of 13.8 nM as detected by LSPR Assay.