Human Novel Coronavirus Spike glycoprotein(S) protein

Product Overview

• Article Name: Human Novel Coronavirus Spike glycoprotein(S) protein
• Biozol Catalog Number: BYT-ORB668864
• Supplier Catalog Number: orb668864
• Alternative Catalog Number: BYT-ORB668864-20,BYT-ORB668864-100,BYT-ORB668864-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: /

Product Description

This Human Novel Coronavirus Spike glycoprotein(S) protein spans the amino acid sequence from region 319-541aa (V483A). Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 27.8 kDa
• UniProt: P0DTC2
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Application Notes

• Application Notes: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5 µg/ml can bind human ACE2, the EC50 is 196.4-272.1 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2 µg/ml can bind SARS-CoV-2-S Antibody, the EC50 is 7.481- 18.76 ng/ml. Application Notes: SARS-CoV-2 Related Proteins

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5 µg/ml can bind human ACE2, the EC50 is 196.4-272.1 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2 µg/ml can bind SARS-CoV-2-S Antibody, the EC50 is 7.481- 18.76 ng/ml.