SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag
Catalog Number:
BYT-ORB669264
| Article Name: |
SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag |
| Biozol Catalog Number: |
BYT-ORB669264 |
| Supplier Catalog Number: |
orb669264 |
| Alternative Catalog Number: |
BYT-ORB669264-100 |
| Manufacturer: |
Biorbyt |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Mouse |
| Alternative Names: |
2019-nCov, COVID-19, NSP9, Nonstructural Protein 9, SARS-CoV-2, coronavirus, covid-19, sars-cov-2 |
| SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. |
| Molecular Weight: |
13.2KD |
| Form: |
Lyophilized |
| Sequence: |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
![]()
|
orb669264 |
