Human DDX39B protein

Catalog Number: BYT-ORB704595
Article Name: Human DDX39B protein
Biozol Catalog Number: BYT-ORB704595
Supplier Catalog Number: orb704595
Alternative Catalog Number: BYT-ORB704595-1,BYT-ORB704595-100,BYT-ORB704595-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 56KDA U2AF65-associated protein,ATP-dependent RNA helicase p47DEAD box protein UAP56HLA-B-associated transcript 1 protein
This Human DDX39B protein spans the amino acid sequence from region 2-251aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 55.2 kDa
UniProt: Q13838
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DDX39B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DDX39B.