Mouse Gfral protein

Catalog Number: BYT-ORB704698
Article Name: Mouse Gfral protein
Biozol Catalog Number: BYT-ORB704698
Supplier Catalog Number: orb704698
Alternative Catalog Number: BYT-ORB704698-1,BYT-ORB704698-100,BYT-ORB704698-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: /
This Mouse Gfral protein spans the amino acid sequence from region 20-349aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 42.1 kDa
UniProt: Q6SJE0
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSES
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Gfral at 5 µg/mL can bind Mouse Gdf15, the EC50 is 7.926-10.52 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Mouse Gfral at 5 µg/ml can bind Mouse Gdf15, the EC50 is 7.926-10.52 ng/mL.