ACE2 protein

Product Overview

• Article Name: ACE2 protein
• Biozol Catalog Number: BYT-ORB705121
• Supplier Catalog Number: orb705121
• Alternative Catalog Number: BYT-ORB705121-1,BYT-ORB705121-100,BYT-ORB705121-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

This ACE2 protein spans the amino acid sequence from region 18-740aa. Purity: Greater than 94.8% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 112.7 kDa
• UniProt: Q56NL1
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Paguma larvata (Masked palm civet)
• Purity: Greater than 94.8% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QSTTEELAKTFLETFNYEAQELSYQSSVASWNYNTNITDENAKNMNEAGAKWSAYYEEQSKLAQTYPLAEIQDAKIKRQLQALQQSGSSVLSADKSQRLNTILNAMSTIYSTGKACNPNNPQECLLLEPGLDNIMENSKDYNERLWAWEGWRAEVGKQLRPLYEEYVALKNEMARANNYEDYGDYWRGDYEEEWTGGYNYSRNQLIQDVEDTFEQIKPLYQHLHAYVRAKLMDTYPSRISRTGCLPAHLLGDMWG

Application Notes

• Application Notes: Biological Origin: Paguma larvata (Masked palm civet). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 µg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml.

Recombinant Paguma larvata ACE2 protein enzyme activity is Measured by its ability to cleave fluorogenic peptide substrate (Mca-Ala-Pro-Lys (Dnp) -OH), The Km is 22.84 µM.

The purity of ACE2 was greater than 90% as determined by SEC-HPLC