Human CD40 protein

Product Overview

• Article Name: Human CD40 protein
• Biozol Catalog Number: BYT-ORB705123
• Supplier Catalog Number: orb705123
• Alternative Catalog Number: BYT-ORB705123-1,BYT-ORB705123-100,BYT-ORB705123-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

This Human CD40 protein spans the amino acid sequence from region 21-193aa. Purity: Greater than 92% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 48 kDa
• UniProt: P25942
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 92% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 µg/ml can bind CD40L, the EC50 is 3.112-3.858 ng/ml.

Human CD40 protein hFc tag captured on COOH chip can bind Human CD40L protein hFc and Flag tag with an affinity constant of 2.06 nM as detected by LSPR Assay.

The purity of CD40 was greater than 95% as determined by SEC-HPLC