Human TNFRSF13C protein

Product Overview

• Article Name: Human TNFRSF13C protein
• Biozol Catalog Number: BYT-ORB705223
• Supplier Catalog Number: orb705223
• Alternative Catalog Number: BYT-ORB705223-1,BYT-ORB705223-100,BYT-ORB705223-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

This Human TNFRSF13C protein spans the amino acid sequence from region 7-71aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 36.4 kDa
• UniProt: Q96RJ3
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 µg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 µg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.2699-0.5613 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 µg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 µg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.2699-0.5613 ng/ml.