Human GDF5 protein

Product Overview

• Article Name: Human GDF5 protein
• Biozol Catalog Number: BYT-ORB705307
• Supplier Catalog Number: orb705307
• Alternative Catalog Number: BYT-ORB705307-10,BYT-ORB705307-100,BYT-ORB705307-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: BMP14, CDMP1, GDF-5, BMP-14, CDMP-1, LAP-4, LPS-associated protein 4, Radotermin

Product Description

This Human GDF5 protein spans the amino acid sequence from region 382-501aa. Purity: > 95 % as determined by SDS-PAGE and HPLC analyses.

Product Properties

• Molecular Weight: 13.6 kDa
• UniProt: P43026
• Buffer: Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
• Source: Homo sapiens (Human)
• Purity: > 95 % as determined by SDS-PAGE and HPLC analyses.
• Form: Lyophilized powder
• Sequence: APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 µg/ml, corresponding to a specific activity of > 1000 IU/mg. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.