Human LGALS8 protein

Product Overview

• Article Name: Human LGALS8 protein
• Biozol Catalog Number: BYT-ORB705315
• Supplier Catalog Number: orb705315
• Alternative Catalog Number: BYT-ORB705315-1,BYT-ORB705315-100,BYT-ORB705315-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Po66 carbohydrate-binding protein

Product Description

This Human LGALS8 protein spans the amino acid sequence from region 1-317aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 62.8 kDa
• UniProt: O00214
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERN

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 µg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 µg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 µg/ml.