Human SINHCAF protein

Catalog Number: BYT-ORB705328
Article Name: Human SINHCAF protein
Biozol Catalog Number: BYT-ORB705328
Supplier Catalog Number: orb705328
Alternative Catalog Number: BYT-ORB705328-1,BYT-ORB705328-100,BYT-ORB705328-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein FAM60A (Tera protein homolog) (C12orf14) (FAM60A)
This Human SINHCAF protein spans the amino acid sequence from region 1-221aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 51.9 kDa
UniProt: Q9NP50
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 µg/ml can bind human SINHCAF, the EC50 of human SINHCAF protein is 31.54-38.59 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 µg/ml can bind human SINHCAF, the EC50 of human SINHCAF protein is 31.54-38.59 µg/ml.