Human ULBP1 protein

Product Overview

• Article Name: Human ULBP1 protein
• Biozol Catalog Number: BYT-ORB705332
• Supplier Catalog Number: orb705332
• Alternative Catalog Number: BYT-ORB705332-1,BYT-ORB705332-100,BYT-ORB705332-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)

Product Description

This Human ULBP1 protein spans the amino acid sequence from region 26-216aa. Purity: Greater than 93% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 52.4 kDa
• UniProt: Q9BZM6
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 93% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 µg/ml can bind human ULBP1, the EC50 of human ULBP1 protein is 228.5-427.6 ng/ml.

Human KLRK1 protein Fc tag captured on COOH chip can bind Human ULBP1 protein Fc/myc tag with an affinity constant of 2.27 nM as detected by LSPR Assay.