Human ICOSLG protein

Product Overview

• Article Name: Human ICOSLG protein
• Biozol Catalog Number: BYT-ORB705334
• Supplier Catalog Number: orb705334
• Alternative Catalog Number: BYT-ORB705334-1,BYT-ORB705334-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: B7 homolog 2 (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1)

Product Description

This Human ICOSLG protein spans the amino acid sequence from region 19-258aa. Purity: Greater than 93% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 28.9 kDa
• UniProt: O75144
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 93% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 µg/ml can bind human ICOS, the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 µg/ml can bind human ICOS, the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml.