Human CD47 protein

Product Overview

• Article Name: Human CD47 protein
• Biozol Catalog Number: BYT-ORB705335
• Supplier Catalog Number: orb705335
• Alternative Catalog Number: BYT-ORB705335-1,BYT-ORB705335-100,BYT-ORB705335-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Antigenic surface determinant protein OA3 (Integrin-associated protein) (IAP) (Protein MER6) (CD47)

Product Description

This Human CD47 protein spans the amino acid sequence from region 19-139aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 41.5 kDa
• UniProt: Q08722
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SIRPA at 2 µg/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml.

Human SIRPA protein His/Myc tag captured on COOH chip can bind Human CD47 protein Fc tag with an affinity constant of 19.1 nM as detected by LSPR Assay.