Human TNFRSF1B protein

Product Overview

• Article Name: Human TNFRSF1B protein
• Biozol Catalog Number: BYT-ORB705337
• Supplier Catalog Number: orb705337
• Alternative Catalog Number: BYT-ORB705337-1,BYT-ORB705337-100,BYT-ORB705337-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD120b) (Etanercept) (TBP-2) (TBPII)

Product Description

This Human TNFRSF1B protein spans the amino acid sequence from region 23-257aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 54.1 kDa
• UniProt: P20333
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNF-alpha at 5 µg/ml can bind human TNFR2, the EC50 of human TNFR2 protein is 1.162-1.481 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized TNF-alpha at 5 µg/ml can bind human TNFR2, the EC50 of human TNFR2 protein is 1.162-1.481 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFRSF1B, the EC50 is 1.632-2.699 ng/ml.