Human KLK2 protein

Catalog Number: BYT-ORB8196
Article Name: Human KLK2 protein
Biozol Catalog Number: BYT-ORB8196
Supplier Catalog Number: orb8196
Alternative Catalog Number: BYT-ORB8196-1,BYT-ORB8196-100,BYT-ORB8196-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Glandular kallikrein-1
Recombinant of human KLK2 protein
Molecular Weight: 30.2 kDa
UniProt: P20151
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Application Notes: Tag info: N-terminal 6xHis-taggedExpression Region: 25-261aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5