Recombinant Alginate lyase(algL)

Product Overview

• Article Name: Recombinant Alginate lyase(algL)
• Biozol Catalog Number: BYT-ORB8219
• Supplier Catalog Number: orb8219
• Alternative Catalog Number: BYT-ORB8219-1,BYT-ORB8219-100,BYT-ORB8219-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Poly(beta-D-mannuronate) lyase

Product Description

This Recombinant Alginate lyase(algL) spans the amino acid sequence from region 24-374aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 59 kDa
• UniProt: O52195
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Azotobacter vinelandii
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGD

Application Notes

• Application Notes: Biological Origin: Azotobacter vinelandii. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Azotobacter vinelandiialgL.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Azotobacter vinelandiialgL.