Human O95822 protein

Catalog Number: BYT-ORB8225
Article Name: Human O95822 protein
Biozol Catalog Number: BYT-ORB8225
Supplier Catalog Number: orb8225
Alternative Catalog Number: BYT-ORB8225-1,BYT-ORB8225-100,BYT-ORB8225-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DCMC_HUMAN, hMCD, Malonyl CoA decarboxylase, Malonyl CoA decarboxylase mitochondrial, Malonyl coenzyme A decarboxylase, Malonyl-CoA decarboxylase, MCD, MGC59795, mitochondrial, Mlycd
This Human O95822 protein spans the amino acid sequence from region 40-493aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 55.9 kDa
UniProt: O95822
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDELLRRAVPPTPAYELREKTPAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLT
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 40-493aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) O95822.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) O95822.