Fish Vertebrate ancient opsin protein

Catalog Number: BYT-ORB9570
Article Name: Fish Vertebrate ancient opsin protein
Biozol Catalog Number: BYT-ORB9570
Supplier Catalog Number: orb9570
Alternative Catalog Number: BYT-ORB9570-1, BYT-ORB9570-100, BYT-ORB9570-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Vertebrate ancient opsin
This Fish Vertebrate ancient opsin protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.5 kDa
Pubmed: 29542047
UniProt: O13018
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Salmo salar (Atlantic salmon)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
Application Notes: Biological Origin: Salmo salar (Atlantic salmon). Application Notes: Tag info: N-terminal 6xHis-B2M-taggedExpression Region: 1-75aaSequence Info: Partial Glycerol content: 0.5