Recombinant Mouse Interleukin-7 protein(Il7) (Active)
Catalog Number:
CSB-AP003331MO
- Images (0)
| Article Name: | Recombinant Mouse Interleukin-7 protein(Il7) (Active) |
| Biozol Catalog Number: | CSB-AP003331MO |
| Supplier Catalog Number: | CSB-AP003331MO |
| Alternative Catalog Number: | CSB-AP003331MO-500, CSB-AP003331MO-100, CSB-AP003331MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | IL-7, |
| Molecular Weight: | 14.9 kDa |
| Tag: | Tag-Free |
| UniProt: | P10168 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 2 % trehalose |
| Source: | E.Coli |
| Expression System: | 26-154aa |
| Purity: | >96% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
Product Guarantee and Expert Support
