Recombinant Mouse Pro-interleukin-16 [Cleaved into: Interleukin-16 protein(Il16) (Active)
Catalog Number:
CSB-AP003381MO
- Images (0)
| Article Name: | Recombinant Mouse Pro-interleukin-16 [Cleaved into: Interleukin-16 protein(Il16) (Active) |
| Biozol Catalog Number: | CSB-AP003381MO |
| Supplier Catalog Number: | CSB-AP003381MO |
| Alternative Catalog Number: | CSB-AP003381MO-500, CSB-AP003381MO-100, CSB-AP003381MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | IL-16, LCF,] |
| Molecular Weight: | 12.2 kDa |
| Tag: | Tag-Free |
| UniProt: | O54824 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Source: | E.Coli |
| Expression System: | 1205-1322aa |
| Purity: | >98% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS |
Product Guarantee and Expert Support
