Recombinant Mouse Interleukin-21 protein(Il21) (Active)
Catalog Number:
CSB-AP003391MO
- Images (0)
| Article Name: | Recombinant Mouse Interleukin-21 protein(Il21) (Active) |
| Biozol Catalog Number: | CSB-AP003391MO |
| Supplier Catalog Number: | CSB-AP003391MO |
| Alternative Catalog Number: | CSB-AP003391MO-500, CSB-AP003391MO-100, CSB-AP003391MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | IL-21, |
| Molecular Weight: | 15.0 kDa |
| Tag: | Tag-Free |
| UniProt: | Q9ES17 |
| Buffer: | Lyophilized from a 0.2 µm filtered 2 * PBS, pH 7.4 |
| Source: | E.Coli |
| Expression System: | 18-146aa |
| Purity: | >98% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS |
Product Guarantee and Expert Support
