Recombinant Mouse Interleukin-22 protein(Il22) (Active)
Catalog Number:
CSB-AP003401MO
- Images (0)
| Article Name: | Recombinant Mouse Interleukin-22 protein(Il22) (Active) |
| Biozol Catalog Number: | CSB-AP003401MO |
| Supplier Catalog Number: | CSB-AP003401MO |
| Alternative Catalog Number: | CSB-AP003401MO-500, CSB-AP003401MO-100, CSB-AP003401MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | IL-22, IL-TIF, IL-TIF alpha, Interleukin-22a, IL-22a |
| Molecular Weight: | 16.6 kDa |
| Tag: | Tag-Free |
| UniProt: | Q9JJY9 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Source: | E.Coli |
| Expression System: | 34-179aa |
| Purity: | >96% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV |
Product Guarantee and Expert Support
