Recombinant Mouse Interleukin-33 protein (Il33), partial (Active)
Catalog Number:
CSB-AP003411MO
- Images (0)
| Article Name: | Recombinant Mouse Interleukin-33 protein (Il33), partial (Active) |
| Biozol Catalog Number: | CSB-AP003411MO |
| Supplier Catalog Number: | CSB-AP003411MO |
| Alternative Catalog Number: | CSB-AP003411MO-500, CSB-AP003411MO-100, CSB-AP003411MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | IL-33,, Interleukin-33109-266,] |
| Molecular Weight: | 17.5 kDa |
| Tag: | Tag-Free |
| UniProt: | Q8BVZ5 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, and 1 mM EDTA |
| Source: | E.Coli |
| Expression System: | 109-266aa |
| Purity: | >98% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Product Guarantee and Expert Support
