Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active)

Catalog Number: CSB-AP003861HU
Article Name: Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active)
Biozol Catalog Number: CSB-AP003861HU
Supplier Catalog Number: CSB-AP003861HU
Alternative Catalog Number: CSB-AP003861HU-1, CSB-AP003861HU-500, CSB-AP003861HU-50, CSB-AP003861HU-10
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Transforming Growth Factor Beta-1, TGF-Beta-1, Latency-Associated Peptide, LAP, TGFB1, TGFB
Molecular Weight: 12.8 kDa
Tag: Tag-Free
UniProt: P01137
Buffer: Lyophilized from a 0.2 µm filtered 50mM Glycine-HCl, 150mMNacl, pH2.5
Source: Mammalian cell
Expression System: 279-390aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.