Recombinant Human Fibroblast growth factor 8 (FGF8) (Active)
Catalog Number:
CSB-AP004031HU
| Article Name: |
Recombinant Human Fibroblast growth factor 8 (FGF8) (Active) |
| Biozol Catalog Number: |
CSB-AP004031HU |
| Supplier Catalog Number: |
CSB-AP004031HU |
| Alternative Catalog Number: |
CSB-AP004031HU-1, CSB-AP004031HU-500, CSB-AP004031HU-50, CSB-AP004031HU-10 |
| Manufacturer: |
Cusabio |
| Category: |
Proteine/Peptide |
| Alternative Names: |
Fibroblast growth factor 8,Androgen-induced growth factor,Heparin-binding growth factor 8,AIGF,HBGF-8,FGF-8B |
| Molecular Weight: |
22.5 kDa |
| Tag: |
Tag-Free |
| UniProt: |
P55075 |
| Buffer: |
Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4 |
| Source: |
E.coli |
| Expression System: |
23-215aa |
| Purity: |
Greater than 95% as determined by SDS-PAGE. |
| Form: |
Lyophilized powder |
| Sequence: |
QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR |
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |