Recombinant Human Fibroblast growth factor 8 (FGF8) (Active)

Catalog Number: CSB-AP004031HU
Article Name: Recombinant Human Fibroblast growth factor 8 (FGF8) (Active)
Biozol Catalog Number: CSB-AP004031HU
Supplier Catalog Number: CSB-AP004031HU
Alternative Catalog Number: CSB-AP004031HU-1, CSB-AP004031HU-500, CSB-AP004031HU-50, CSB-AP004031HU-10
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Fibroblast growth factor 8,Androgen-induced growth factor,Heparin-binding growth factor 8,AIGF,HBGF-8,FGF-8B
Molecular Weight: 22.5 kDa
Tag: Tag-Free
UniProt: P55075
Buffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Source: E.coli
Expression System: 23-215aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.