Recombinant Human Interferon gamma(IFNG) (Active)
Catalog Number:
CSB-AP004201HU
- Images (0)
| Article Name: | Recombinant Human Interferon gamma(IFNG) (Active) |
| Biozol Catalog Number: | CSB-AP004201HU |
| Supplier Catalog Number: | CSB-AP004201HU |
| Alternative Catalog Number: | CSB-AP004201HU-1, CSB-AP004201HU-500, CSB-AP004201HU-50, CSB-AP004201HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Interferon Gamma, IFN-Gamma, Immune Interferon, IFNG |
| Molecular Weight: | 16.88 kDa |
| Tag: | Tag-Free |
| UniProt: | P01579 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution of 20mM Tris-HCl, 250mM NaCl, pH 8.5. |
| Source: | E.coli |
| Expression System: | 24-166aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
Product Guarantee and Expert Support
