Recombinant Human Interferon gamma (IFNG) (Active)

Catalog Number: CSB-AP004201HU
Article Name: Recombinant Human Interferon gamma (IFNG) (Active)
Biozol Catalog Number: CSB-AP004201HU
Supplier Catalog Number: CSB-AP004201HU
Alternative Catalog Number: CSB-AP004201HU-1, CSB-AP004201HU-500, CSB-AP004201HU-50, CSB-AP004201HU-10
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Interferon Gamma, IFN-Gamma, Immune Interferon, IFNG
Molecular Weight: 16.88 kDa
Tag: Tag-Free
UniProt: P01579
Buffer: Lyophilized from a 0.2 µm filtered 20mM Tris-HCl, 250mM NaCl, pH 8.5.
Source: E.coli
Expression System: 24-166aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.