Recombinant Human Interferon gamma (IFNG) (Active)
Catalog Number:
CSB-AP004201HU
| Article Name: |
Recombinant Human Interferon gamma (IFNG) (Active) |
| Biozol Catalog Number: |
CSB-AP004201HU |
| Supplier Catalog Number: |
CSB-AP004201HU |
| Alternative Catalog Number: |
CSB-AP004201HU-1, CSB-AP004201HU-500, CSB-AP004201HU-50, CSB-AP004201HU-10 |
| Manufacturer: |
Cusabio |
| Category: |
Proteine/Peptide |
| Alternative Names: |
Interferon Gamma, IFN-Gamma, Immune Interferon, IFNG |
| Molecular Weight: |
16.88 kDa |
| Tag: |
Tag-Free |
| UniProt: |
P01579 |
| Buffer: |
Lyophilized from a 0.2 µm filtered 20mM Tris-HCl, 250mM NaCl, pH 8.5. |
| Source: |
E.coli |
| Expression System: |
24-166aa |
| Purity: |
Greater than 95% as determined by SDS-PAGE. |
| Form: |
Lyophilized powder |
| Sequence: |
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |