Recombinant Mouse Granzyme K (Gzmk)

Catalog Number: CSB-BP010084MO
Article Name: Recombinant Mouse Granzyme K (Gzmk)
Biozol Catalog Number: CSB-BP010084MO
Supplier Catalog Number: CSB-BP010084MO
Alternative Catalog Number: CSB-BP010084MO-1, CSB-BP010084MO-100, CSB-BP010084MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 29.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O35205
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Baculovirus
Expression System: 26-263aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQLLHLGSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLICKGIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLAPSRAH
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.