Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1)

Catalog Number: CSB-BP010602MO
Article Name: Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1)
Biozol Catalog Number: CSB-BP010602MO
Supplier Catalog Number: CSB-BP010602MO
Alternative Catalog Number: CSB-BP010602MO-1, CSB-BP010602MO-100, CSB-BP010602MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: hnRNP A2/B1
Molecular Weight: 43 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O88569
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Baculovirus
Expression System: 1-353aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGN
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.