Recombinant Human Adiponectin receptor protein 1 (ADIPOR1)

Catalog Number: CSB-CF001367HU
Article Name: Recombinant Human Adiponectin receptor protein 1 (ADIPOR1)
Biozol Catalog Number: CSB-CF001367HU
Supplier Catalog Number: CSB-CF001367HU
Alternative Catalog Number: CSB-CF001367HU-100, CSB-CF001367HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Progestin and adipoQ receptor family member I
Molecular Weight: 62.6 kDa
Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
UniProt: Q96A54
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-375aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQW
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.