Recombinant Human 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1)

Catalog Number: CSB-EP001117HUC7
Article Name: Recombinant Human 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1)
Biozol Catalog Number: CSB-EP001117HUC7
Supplier Catalog Number: CSB-EP001117HUc7
Alternative Catalog Number: CSB-EP001117HUC7-1, CSB-EP001117HUC7-100, CSB-EP001117HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Acetyl-CoA C-myristoyltransferase,Acetyl-CoA acyltransferase,Beta-ketothiolase,Peroxisomal 3-oxoacyl-CoA thiolase
Molecular Weight: 38.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P09110
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.246.
Source: E.coli
Expression System: 27-331aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVA
Application Notes: Research Areas: Cancer