Recombinant Rat Acyl-coenzyme A thioesterase 1 (Acot1)

Catalog Number: CSB-EP001163RA
Article Name: Recombinant Rat Acyl-coenzyme A thioesterase 1 (Acot1)
Biozol Catalog Number: CSB-EP001163RA
Supplier Catalog Number: CSB-EP001163RA
Alternative Catalog Number: CSB-EP001163RA-1, CSB-EP001163RA-100, CSB-EP001163RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: CTE-I,Inducible cytosolic acyl-coenzyme A thioester hydrolase,LACH2,Long chain acyl-CoA thioester hydrolase,Palmitoyl-coenzyme A thioesterase
Molecular Weight: 52.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O88267
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.211.
Source: E.coli
Expression System: 1-419aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEATLSLEPAGRSCWDEPLSITVRGLVPEQPVTLRAALRDEKGALFRARALYRADAHGELDLARAPALGGSFTGLEPMGLIWAMEPERPFWRLVKRDVQTPFVVELEVLDGHEPDGGRLLARAVHERHFMAPGVRRVPVREGRVRATLFLPPEPGPFPGIIDLFGVGGGLLEYRASLLAGKGFAVMALAYYNYDDLPKTMETMRIEYFEEAVNYLRGHPEVKGPGIGLLGISKGGELGLAMASFLKGITAAVVIN
Application Notes: Research Areas: Cardiovascular