Recombinant Mouse Muellerian-inhibiting factor (Amh), partial
Catalog Number:
CSB-EP001666MOA0
- Images (0)
| Article Name: | Recombinant Mouse Muellerian-inhibiting factor (Amh), partial |
| Biozol Catalog Number: | CSB-EP001666MOA0 |
| Supplier Catalog Number: | CSB-EP001666MOa0 |
| Alternative Catalog Number: | CSB-EP001666MOA0-1, CSB-EP001666MOA0-100, CSB-EP001666MOA0-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Anti-Muellerian hormone ,AMH,Muellerian-inhibiting substance ,MIS |
| Molecular Weight: | 15.4 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P27106 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 450-552aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC |
Product Guarantee and Expert Support
