Recombinant Human Aldehyde oxidase (AOX1), partial

Catalog Number: CSB-EP001858HUC7
Article Name: Recombinant Human Aldehyde oxidase (AOX1), partial
Biozol Catalog Number: CSB-EP001858HUC7
Supplier Catalog Number: CSB-EP001858HUc7
Alternative Catalog Number: CSB-EP001858HUC7-1, CSB-EP001858HUC7-100, CSB-EP001858HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Aldehyde oxidase 1,Azaheterocycle hydroxylase
Molecular Weight: 27.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q06278
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.251.
Source: E.coli
Expression System: 236-421aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRK
Application Notes: Research Areas: Metabolism