Recombinant Human Activating signal cointegrator 1 complex subunit 3 (ASCC3)

Catalog Number: CSB-EP002198HUC7
Article Name: Recombinant Human Activating signal cointegrator 1 complex subunit 3 (ASCC3)
Biozol Catalog Number: CSB-EP002198HUC7
Supplier Catalog Number: CSB-EP002198HUc7
Alternative Catalog Number: CSB-EP002198HUC7-1, CSB-EP002198HUC7-100, CSB-EP002198HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: ASC-1 complex subunit p200,Helicase, ATP binding 1,Trip4 complex subunit p200
Molecular Weight: 19.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8N3C0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.162.
Source: E.coli
Expression System: 1-111aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR
Application Notes: Research Areas: Neuroscience