Recombinant Human Serine/threonine-protein kinase B-raf (BRAF)(V600E), partial

Catalog Number: CSB-EP002791HU4(M)
Article Name: Recombinant Human Serine/threonine-protein kinase B-raf (BRAF)(V600E), partial
Biozol Catalog Number: CSB-EP002791HU4(M)
Supplier Catalog Number: CSB-EP002791HU4(M)
Alternative Catalog Number: CSB-EP002791HU4(M)-1, CSB-EP002791HU4(M)-100, CSB-EP002791HU4(M)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Proto-oncogene B-Raf,p94,v-Raf murine sarcoma viral oncogene homolog B1
Molecular Weight: 49.6 kDa
Tag: C-terminal 11xHis-tagged
UniProt: P15056
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.199.
Source: E.coli
Expression System: 416-766aa(V600E)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVG
Application Notes: Research Areas: Cancer