Recombinant Human Calcitonin gene-related peptide 2 (CALCB), partial

Catalog Number: CSB-EP004435HU1
Article Name: Recombinant Human Calcitonin gene-related peptide 2 (CALCB), partial
Biozol Catalog Number: CSB-EP004435HU1
Supplier Catalog Number: CSB-EP004435HU1
Alternative Catalog Number: CSB-EP004435HU1-1, CSB-EP004435HU1-100, CSB-EP004435HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Beta-type CGRP,Calcitonin gene-related peptide II
Molecular Weight: 10.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P10092
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.206.
Source: E.coli
Expression System: 82-118aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Application Notes: Research Areas: Neuroscience