Recombinant Rat Glycoprotein hormones alpha chain (Cga)

Catalog Number: CSB-EP005293RA
Article Name: Recombinant Rat Glycoprotein hormones alpha chain (Cga)
Biozol Catalog Number: CSB-EP005293RA
Supplier Catalog Number: CSB-EP005293RA
Alternative Catalog Number: CSB-EP005293RA-1, CSB-EP005293RA-100, CSB-EP005293RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Anterior pituitary glycoprotein hormones common subunit alpha,Follicle-stimulating hormone alpha chain,Follitropin alpha chain,Luteinizing hormone alpha chain,Lutropin alpha chain,Thyroid-stimulating hormone alpha chain,Thyrotropin alpha chain
Molecular Weight: 17.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P11962
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.240.
Source: E.coli
Expression System: 25-120aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS
Application Notes: Research Areas: Epigenetics and Nuclear Signaling