Recombinant Human Probable ATP-dependent RNA helicase DDX5 (DDX5)

Catalog Number: CSB-EP006630HUD7
Article Name: Recombinant Human Probable ATP-dependent RNA helicase DDX5 (DDX5)
Biozol Catalog Number: CSB-EP006630HUD7
Supplier Catalog Number: CSB-EP006630HUd7
Alternative Catalog Number: CSB-EP006630HUD7-1, CSB-EP006630HUD7-100, CSB-EP006630HUD7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: DEAD box protein 5,RNA helicase p68
Molecular Weight: 78.9 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P17844
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.145.
Source: E.coli
Expression System: 1-614aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLD
Application Notes: Research Areas: Epigenetics and Nuclear Signaling