Recombinant Human DNA replication ATP-dependent helicase/nuclease DNA2 (DNA2), partial

Catalog Number: CSB-EP006982HUA2
Article Name: Recombinant Human DNA replication ATP-dependent helicase/nuclease DNA2 (DNA2), partial
Biozol Catalog Number: CSB-EP006982HUA2
Supplier Catalog Number: CSB-EP006982HUa2
Alternative Catalog Number: CSB-EP006982HUA2-1, CSB-EP006982HUA2-100, CSB-EP006982HUA2-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: DNA replication ATP-dependent helicase-like homolog
Molecular Weight: 68.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P51530
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.207.
Source: E.coli
Expression System: 81-519aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRSSDPATRQMLIGTVLHEVFQKAINNSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRADPEAGLLLY
Application Notes: Research Areas: Epigenetics and Nuclear Signaling