Recombinant Mouse EGF-containing fibulin-like extracellular matrix protein 1 (Efemp1)

Catalog Number: CSB-EP007450MOA0
Article Name: Recombinant Mouse EGF-containing fibulin-like extracellular matrix protein 1 (Efemp1)
Biozol Catalog Number: CSB-EP007450MOA0
Supplier Catalog Number: CSB-EP007450MOa0
Alternative Catalog Number: CSB-EP007450MOA0-1, CSB-EP007450MOA0-100, CSB-EP007450MOA0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Fibulin-3
Molecular Weight: 60.0 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q8BPB5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.202.
Source: E.coli
Expression System: 18-493aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QYTEETITYTQCTDGYEWDPIRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEHPQQETPAAEASSGATTGTVAARSMATSGVVPGGGFMASATAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTSGTHNCRTDQVCINLRGSFTCQCLPGYQKRGEQCVDIDECTVPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNIL
Application Notes: Research Areas: Neuroscience