Recombinant Human Estrogen receptor (ESR1), partial

Catalog Number: CSB-EP007830HU5
Article Name: Recombinant Human Estrogen receptor (ESR1), partial
Biozol Catalog Number: CSB-EP007830HU5
Supplier Catalog Number: CSB-EP007830HU5
Alternative Catalog Number: CSB-EP007830HU5-1, CSB-EP007830HU5-100, CSB-EP007830HU5-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1
Molecular Weight: 22.5 kDa
Tag: N-terminal 6xHis-ABP-tagged
UniProt: P03372
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 89-230aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
Application Notes: Research Areas: Transcription. Endotoxin: Not test