Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)
Catalog Number:
CSB-EP008625BO-WD1
- Images (0)
| Article Name: | Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active) |
| Biozol Catalog Number: | CSB-EP008625BO-WD1 |
| Supplier Catalog Number: | CSB-EP008625BO-WD1 |
| Alternative Catalog Number: | CSB-EP008625BO-WD1-1, CSB-EP008625BO-WD1-50 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Fibroblast Growth Factor 2, FGF-2, Basic Fibroblast Growth Factor, bFGF, Heparin-Binding Growth Factor 2, HBGF-2, FGF2, FGFB |
| Molecular Weight: | 16.5 kDa |
| Tag: | Tag free |
| UniProt: | P03969 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution containing 10mMPB, 250mMNaCl,5%mannitol and 0.01% Tween 80 ,pH 7.4 |
| Source: | E.coli |
| Expression System: | 10-155aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
Product Guarantee and Expert Support
